General Information

  • ID:  hor006887
  • Uniprot ID:  P02778??23-98)
  • Protein name:  C-X-C motif chemokine 10
  • Gene name:  LHB
  • Organism:  Homo sapiens
  • Family:  Intercrine alpha (chemokine CxC) family
  • Source:  Human
  • Expression:  Mainly secreted by monocytes; endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0008603 cAMP-dependent protein kinase regulator activity; GO:0042056 chemoattractant activity; GO:0048248 CXCR3 chemokine receptor binding; GO:0008009 chemokine activity; GO:0045236 CXCR chemokine receptor binding; GO:0008201 heparin binding; GO:0005102 signaling receptor binding
  • GO CC:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010818 T cell chemotaxis; GO:0008201; F:heparin binding; IMP:UniProtKB.; GO:0007165 signal transduction; GO:0070098 chemokine-mediated signaling pathway; GO:0010332 response to gamma radiation; GO:0007267 cell-cell signaling; GO:0034605 cellular response to heat; GO:0097398 cellular response to interleukin-17; GO:0071222 cellular response to lipopolysaccharide; GO:0010819 regulation of T cell chemotaxis; GO:0006935 chemotaxis; GO:0042118 endothelial cell activation; GO:0007186 G protein-coupled receptor signaling pathway; GO:0006954 inflammatory response; GO:0007517 muscle organ development; GO:0016525 negative regulation of angiogenesis; GO:0045662 negative regulation of myoblast differentiation; GO:1901740 negative regulation of myoblast fusion; GO:0030593 neutrophil chemotaxis; GO:0033280 response to vitamin D; GO:0008284 positive regulation of cell population proliferation; GO:0090026 positive

Sequence Information

  • Sequence:  PLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
  • Length:  76
  • Propeptide:  MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
  • Signal peptide:  MNQTAILICCLIFLTLSGIQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA